PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.K01056.1.p
Common NameEUGRSUZ_K01056, LOC104424947
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 460aa    MW: 48814.6 Da    PI: 6.5703
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.K01056.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like80.32.2e-25197248355
           G2-like   3 rlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       +++Wtp+LH++Fv+aveqL G +kA+P++ilelm+ ++L +++++SHLQkYR+
  Eucgr.K01056.1.p 197 KVDWTPDLHRKFVQAVEQL-GVDKAVPSRILELMGNDSLNRHNIASHLQKYRS 248
                       899****************.********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.742192251IPR017930Myb domain
SuperFamilySSF466894.84E-16193251IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-24193252IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-23195249IPR006447Myb domain, plants
PfamPF002492.7E-7198247IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009910Biological Processnegative regulation of flower development
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 460 aa     Download sequence    Send to blast
MRLFVPCRLE EDRDLGMLAV PPLREERGDE TRRGETCFSI AGAGAGGGGG GGEDDVALFL  60
NFSDAGDLLD SINFDDIFAG DDALPDLEMD AAEVSTEFST GSENQAKANP SVTWDGGGPK  120
ELSEAEERSG SAAGAGAGAG EVSSSGGEGS EKKREGRSGG KRKEERDRGR RSSAAAAAAA  180
AAQGKTNPQA QGKRKFKVDW TPDLHRKFVQ AVEQLGVDKA VPSRILELMG NDSLNRHNIA  240
SHLQKYRSQR RHLQSLEADA ARWSKRRQIY GGAAAAGGGS KRVMTPWAAP AMGFPPAPPS  300
VHHFRPLHVW GHPTLSPSLK HGAWPLHSQP SLVPSPLPTW VPPPLLEHPP PPPPLPPPDP  360
SYWHQQGFGF APVPGIPHHQ GVYKIDPSIG VLTPTGQLAS SQPSFDFHQW SESVDAAIGE  420
VLSKPWQPLP LGLKPPSLEC VLGELQRQGI ASIPPASSP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-15192247257ARR10-B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.K01056.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010035797.10.0PREDICTED: transcription activator GLK2-like
TrEMBLA0A059A0K20.0A0A059A0K2_EUCGR; Uncharacterized protein
STRINGGLYMA12G33430.11e-108(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22092773
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.12e-51GBF's pro-rich region-interacting factor 1